Purity:Purified by Protein A/G affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Specificity:Recognizes human DOG-1 (ANO1).
Clone # USB:DG1/447 + DOG-1.1 (mixture of 2 clones)
Isotype:IgG1,k
Calc Applications Abbrev:IF IHC IP WB
Calc Crossreactivity:Hu
Immunogen:Recombinant human DOG-1 protein (clone DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (clone DOG-1.1). Cellular Localization: Cell Surface and Cytoplasmic