Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Specificity:Recognizes human GAN.
Clone # USB:4G7
Isotype:IgG2a,k
Calc Applications Abbrev:FLISA IC IF WB
Calc Crossreactivity:Hu
Immunogen:Partial recombinant protein corresponding to aa534-598 of GAN (NP_071324) with GST tag. MW of the GST tag alone is 26kD. AA Sequence:DLDTGTNYDYVREFKRSTGTWHHTKPLLPSDLRRTGCAALRIANCKLFRLQLQQGLFRIRVHSP