Purity:Purified by Protein A/G affinity chromatography.
Form:Supplied as a liquid in 10mM PBS. No preservative added. BSA-Free. Labeled with R-Phycoerythrin (PE).
Specificity:Recognizes human DOG-1 (ANO1).
Clone # USB:DG1/447, DOG-1.1
Isotype:IgG1,k
Calc Applications Abbrev:IF IHC IP WB
Calc Crossreactivity:Hu
Immunogen:Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). Cellular Localization: Cell Surface and Cytoplasmic