Purity:Purified by Protein G affinity chromatography.
Form:Supplied as a liquid in PBS, 1% BSA and 0.05% sodium azide.
Specificity:Recognizes human TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP)-associated Factor, 135kD.
Clone # USB:305C2a
Isotype:IgG1
Calc Applications Abbrev:DB WB
Calc Crossreactivity:Hu
Immunogen:Partial sequence of recombinant full-length protein to human TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP)-associated Factor corresponding to amino acids within the C-terminal portion of the protein. Immunogen sequence: ETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQFT