85-6156-72　Tumor Necrosis Factor, Active, Recombinant, Mouse, aa89-235 (Tnf) 10ug　587069

特徴

• Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.
• Partial recombinant protein corresponding to aa89-235 from mouse Tumor necrosis factor, expressed in E.coli.
• Molecular Weight:~16.4kD
• Biological Activity:The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells is less than 0.08ng/ml in the presence of the metabolic inhibitor actinomycin D.
• Amino Acid Sequence:DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
• Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.