85-6156-56　［取扱停止］Tumor Necrosis Factor Receptor Superfamily Member 1A, Active, Recombinant, Human, His-Tag, aa22-211 (TNFRSF1A) 10ug　587061

特徴

• Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
• Partial recombinant protein corresponding to aa22-211 from human Tumor necrosis factor receptor superfamily member 10C, fused to 6xHis-Tag at C-terminal, expressed in E.coli.
• Molecular Weight:~23.5kD
• Biological Activity:The ED50 as determined by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L?929 mouse fibroblast cells is less than 500ng/ml in the presence of the metabolic inhibitor actinomycin D.
• Amino Acid Sequence:IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
• Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.