85-6156-33　Tumor Necrosis Factor Ligand Superfamily Member 11, Active, Recombinant, Human, His-Tag, aa140-317 (TNFSF11) 50ug　587049

特徴

• Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy.
• Partial recombinant protein corresponding to aa140-317 from human Tumor necrosis factor ligand superfamily member 11, fused 6xHis-Tag at N-terminal, expressed in E. coli.
• Molecular Weight:~22.4kD
• Biological Activity:The ED50 as determined by its ability to binding SF11A used funtional ELISA is less than 10ug/ml.
• Amino Acid Sequence:IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
• Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.