85-6154-43　Interleukin-15 & Interleukin-15 Receptor Subunit alpha, Active, Recombinant, Human, hFc-Tag, aa31-96 & aa49-162 (IL15 & IL15RA) 10ug　586952

特徴

• High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK.
• Partial recombinant protein corresponding to aa31-96 & aa49-162 from human Interleukin 15 & Interleukin 15 subunit alpha, fused to hFc-Tag at C-terminal, expressed in Mammalian cells.
• Molecular Weight:~46.9kD
• Biological Activity:The ED50 as determined in a cell proliferation assay using CTLL?2 mouse cytotoxic T cells is less than 20ng/ml
• Amino Acid Sequence:ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD & NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.