85-6154-15　Interleukin-1 alpha, Active, Recombinant, Human, aa113-271 (IL1A) 50ug　586936

特徴

• Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
• Recombinant protein corresponding to aa113-271 from human Interleukin 1 alpha, expressed in E. coli.
• Molecular Weight:~18kD
• Biological Activity:The ED50 as determined by its ability to induce NFKB reporter gene expression in HEK 293 cell line is less than 50pg/ml.
• Amino Acid Sequence:SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
• Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.