85-6154-10　Interferon lambda-3, Active, Recombinant, Human, His-Tag, aa22-196 (IFNL3) 10ug　586934

特徴

• Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets.
• Recombinant protein corresponding to aa22-196 from human Interferon lambda 3, fused to 6xHis-Tag at C-terminal, expressed in Mammalian cells.
• Molecular Weight:~20.67kD
• Biological Activity:The ED50 as determined by its ability to binding IL10RB used funtional ELISA is less than 10ug/ml.
• Amino Acid Sequence:VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
• Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer