85-6153-89　［取扱停止］Insulin-like Growth Factor I, Active, Recombinant, Human, aa49-118 (IGF1) 10ug　586924

特徴

• The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation
• Recombinant protein corresponding to aa49-118 from human Insulin-like growth factor I, expressed in E.coli.
• Molecular Weight:~7.6kD
• Biological Activity:The ED50 as determined in a serum-free cell proliferation assay using MCF?7 human breast cancer cells is typically 1-15ng/ml.
• Amino Acid Sequence:GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Storage and Stability:Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.