85-6152-99　［取扱停止］Erythropoietin, Active, Recombinant, Human, His-Tag, aa28-193 (EPO) 50ug　586879

特徴

• Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
• Recombinant protein corresponding to aa28-193 from human Erythropoietin fused to 6X His-Tag at C-terminal, expressed in mammalian cells.
• Molecular Weight:~19.2kD
• Biological Activity:The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 5ng/ml.
• Amino Acid Sequence:APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
• Storage and Stability:Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.