85-6152-91　Ephrin-A4, Active, Recombinant, Human, His-hFc-Tag, aa26-171 (EFNA4) 50ug　586875

特徴

• Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils.
• Partial recombinant protein corresponding to aa26-171 from human Ephrin-A4, fused to 6xHis-hFc-Tag at C-terminal, expressed in Mammalian cells.
• Molecular Weight:~44.3kD
• Biological Activity:The ED50 as determined by its ability to bind human EphA7 in functional ELISA is less than 10ug/ml.
• Amino Acid Sequence:LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG
• Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.