85-6152-59　［取扱停止］Carbonic Anhydrase 4, Active, Recombinant, Human, His-Tag, aa19-283 (CA4) 50ug　586858

特徴

• Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It is essential for acid overload removal from the retina and retina epithelium, and acid release in the choriocapillaris in the choroid.
• Partial recombinant protein corresponding to aa19-283 from human Parathyroid hormone, fused to 6xHis-Tag at C-terminal, expressed in E.coli.
• Molecular Weight:~31.43kD
• Biological Activity:The esterase activity is determined to be greater than 500pmol/min/ug.
• Amino Acid Sequence:AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK
• Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.