85-6152-46　［取扱停止］C-X-C motif chemokine 3, Active, Recombinant, Human, His-Tag, a35-107 (CXCL3) 10ug　586852

特徴

• Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.
• Recombinant protein corresponding to aa35-107 from human C-X-C motif chemokine 3, fused to 6X His-Tag at N-terminal, expressed in E. coli.
• Molecular Weight:~10.1kD
• Biological Activity:The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is typically 80ng/mL.
• Amino Acid Sequence:ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
• Storage and Stability:Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.