85-6143-50　Solute Carrier Family 2, Facilitated Glucose Transporter Member 1, Recombinant, Mouse, aa451-492 20ug　586376

特徴

• Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake. Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses. Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain. In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors.
• Source:Recombinant protein corresponding to aa451-492 from mouse Solute carrier family 2, facilitated glucose transporter member 1, expressed in E.coli.
• Molecular Weight:~4.5kD
• Amino Acid Sequence:KVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.