85-6134-41　Probable L,D-transpeptidase YbiS, Recombinant, E. coli O6:H1, aa25-306, His-Tag, Myc-Tag 100ug　585887

特徴

• Responsible, at least in part, for anchoring of the major outer membrane lipoprotein (Lpp) to the peptidoglycan via a meso-diaminopimelyl-L-Lys- bond on the terminal residue of Lpp.
• Source:Recombinant protein corresponding to aa25-306 from E. coli O6:H1 Probable L,D-transpeptidase YbiS, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli.
• Molecular Weight:~38.3kD
• Amino Acid Sequence:VTYPLPTDGSRLVGQNQVITIPEGNTQPLEYFAAEYQMGLSNMMEANPGVDTFLPKGGTVLNIPQQLILPDTVHEGIVINSAEMRLYYYPKGTNTVIVLPIGIGQLGKDTPINWTTKVERKKAGPTWTPTAKMHAEYRAAGEPLPAVVPAGPDNPMGLYALYIGRLYAIHGTNANFGIGLRVSHGCVRLRNEDIKFLFEKVPVGTRVQFIDEPVKATTEPDGSRYIEVHNPLSTTEAQFEGQEIVPITLTKSVQTVTGQPDVDQVVLDEAIKNRSGMPVRLN
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.