85-6134-21　Probable Cutinase Rv1984c, Recombinant, Mycobacterium tuberculosis, aa33-217, His-SUMO-Tag, Myc-Tag 20ug　585876

特徴

• Shows esterase activity, with a preference for short- and medium-chain fatty acids. Has also weak lipase activity, but does not exhibit cutinase activity. Hydrolyzes various esters, including pNP-butyrate (C4), pNP-valerate (C5), pNP-hexanoate (C6), pNP-octanoate (C8) and pNP-decanoate (C10). Can use pNP-laurate (C12) and pNP-myristate (C14), with lower efficiency. Can also hydrolyze monocaprylin and triolein, with a slow turnover.; Induces a strong delayed-type hypersensitivity (DTH) response in animal model of tuberculosis, cellular and humoral immune responses. Induces interferon-gamma (IFN-gamma) release in animal models and in human TB patients. Also induces IL-12 responses in mouse model.
• Source:Recombinant protein corresponding to aa33-217 from Mycobacterium tuberculosis Probable cutinase Rv1984c, fused to 10X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli.
• Molecular Weight:~38.7kD
• Amino Acid Sequence:DPCSDIAVVFARGTHQASGLGDVGEAFVDSLTSQVGGRSIGVYAVNYPASDDYRASASNGSDDASAHIQRTVASCPNTRIVLGGYSQGATVIDLSTSAMPPAVADHVAAVALFGEPSSGFSSMLWGGGSLPTIGPLYSSKTINLCAPDDPICTGGGNIMAHVSYVQSGMTSQAATFAANRLDHAG
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.