85-6130-55　Outer-membrane Lipoprotein Carrier Protein, Recombinant, E. coli O9:H4, aa22-203, His-Tag 100ug　585682

特徴

• Participates in the translocation of lipoproteins from the inner membrane to the outer membrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner membrane).
• Source:Recombinant protein corresponding to aa22-203 from Escherichia coli O9:H4 Outer-membrane lipoprotein carrier protein, fused to 6X His-Tag at N-terminal, expressed in E.coli.
• Molecular Weight:~24.3kD
• Amino Acid Sequence:DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.