85-6112-10　Glutathione S-transferase Class-mu 26kD Isozyme, Recombinant, Schistosoma japonicum, aa2-218, His-Tag 20ug　584693

特徴

• Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.; GST isoenzymes appear to play a central role in the parasite detoxification system. Other functions are also suspected including a role in increasing the solubility of haematin in the parasite gut.
• Source:Recombinant protein corresponding to aa2-218 from Schistosoma japonicum Glutathione S-transferase class-mu 26kD isozyme, fused to 6X His-Tag at N-terminal, expressed in Yeast.
• Molecular Weight:~30.4kD
• Amino Acid Sequence:MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFPGRLERPHRD
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.