85-6111-89　Glutamate Receptor ionotropic, NMDA, Recombinant, Human, aa834-938, His-Tag 20ug　584683

特徴

• Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+).
• Source:Recombinant protein corresponding to aa834-938 from human Glutamate receptor ionotropic, NMDA, fused to 6X His-Tag at N-terminal, expressed in E.coli.
• Molecular Weight:~18.0kD
• Amino Acid Sequence:EIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.