85-6107-23　Epididymal Secretory Protein E1, Recombinant, Canine, aa22-149, His-SUMO-Tag 20ug　584434

特徴

• Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the lysosomal compartment. Unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes is transferred by NPC2 to the cholesterol-binding pocket in the N-terminal domain of NPC1. May bind and mobilize cholesterol that is associated with membranes. NPC2 binds cholesterol with a 1:1 stoichiometry. Can bind a variety of sterols, including lathosterol, desmosterol and the plant sterols stigmasterol and beta-sitosterol. The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport.
• Source:Recombinant protein corresponding to aa22-149 from canine Epididymal secretory protein E1, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli.
• Molecular Weight:~30.0kD
• Amino Acid Sequence:VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.