85-6104-06　Disintegrin EC3B, Recombinant, Echis carinatus, aa1-67, His-SUMO-Tag 100ug　584264

特徴

• Inhibits adhesion of cells expressing alpha-4/beta-1 (ITGA4/ITGB1) and alpha-4/beta-7 (ITGA4/ITGB7) integrins to the natural ligands vascular cell adhesion molecule 1 (VCAM-1) and mucosal addressin cell adhesion molecule 1 (MADCAM-1). It is also a weaker inhibitor of alpha-5/beta-1 (ITGA5/ITGB1) and alpha-2b/beta-3 (ITGA2B/ITGB3) integrins. The inhibitory activity of EC3 towards alpha-4 integrins is associated with the MLD sequence of EC3B subunit. The ability of EC3 to inhibit ITGA5/ITGB1 resides in both subunits A and B.
• Source:Recombinant protein corresponding to aa1-67 from Echis carinatus Disintegrin EC3B fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli.
• Molecular Weight:~23.4kD
• Amino Acid Sequence:NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRAMLDGLNDYCTGISTDCPRNRYKGKED
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.