85-6102-71　Dedicator of Cytokinesis Protein 8, Recombinant, Mouse, aa1633-2067, His-Tag 100ug　584190

特徴

• Guanine nucleotide exchange factor (GEF) which specifically activates small GTPase CDC42 by exchanging bound GDP for free GTP. During immune responses, required for interstitial dendritic cell (DC) migration by locally activating CDC42 at the leading edge membrane of DC. Required for CD4(+) T-cell migration in response to chemokine stimulation by promoting CDC42 activation at T cell leading edge membrane. Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing.
• Source:Recombinant protein corresponding to aa1633-2067 from mouse Dedicator of cytokinesis protein 8, fused to 6X His-Tag at N-terminal, expressed in E.coli.
• Molecular Weight:~55.8kD
• Amino Acid Sequence:KSYQASPDLRLTWLQNMAEKHTKKKCFTEAAMCLVHAAALVAEYLSMLEDHSYLPVGSVSFQNISSNVLEESAVSDDTLSPDEDGVCSGRYFTESGLVGLLEQAAELFSTGGLYETVNEVYKLVIPILEAHRDFRKLTSTHDKLQKAFDNIINKDHKRMFGTYFRVGFYGSRFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQHRRNTVLTTMHAFPYIKTRIRVSQKEEFVLTPIEVAIEDMKKKTLQLAVATHQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNRRLITAEQREYQQELKKNYNKLRDSLRPMIERKIP
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.