85-6100-41　Complement C5, Recombinant, Rat, aa1-77, His-Tag, Myc-Tag 20ug　584069

特徴

• Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
• Source:Recombinant protein corresponding to aa1-77 from rat Complement C5, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli.
• Molecular Weight:~14.0kD
• Amino Acid Sequence:DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.