85-6097-41　Carbon Dioxide-concentrating Mechanism Protein CcmK Homolog 2, Recombinant, Synechocystis sp., aa2-103, His-Tag, Myc-Tag 100ug　583907

特徴

• One of the shell proteins of the carboxysome, a polyhedral inclusion where RuBisCO (ribulose bisphosphate carboxylase, rbcL-rbcS) is sequestered. The central pore probably regulates metabolite flux. Hexamers make sheets that form the facets of the polyhedral carboxysome (Probable).
• Source:Recombinant protein corresponding to aa2-103 from Synechocystis sp. Carbon dioxide-concentrating mechanism protein CcmK homolog 2, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli.
• Molecular Weight:~18.4kD
• Amino Acid Sequence:SIAVGMIETRGFPAVVEAADSMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVSAGIEAANRVNGGEVLSTHIIARPHENLEYVLPIRYTEEVEQFRTY
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.