85-6095-83　Branched-chain-amino-acid Aminotransferase, Cytosolic, Recombinant, Mouse, aa1-386, His-Tag 100ug　583825

特徴

• Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.
• Source:Recombinant protein corresponding to aa1-386 from mouse Branched-chain-amino-acid aminotransferase, cytosolic, fused to 10X His-Tag at N-terminal, expressed in E.coli.
• Molecular Weight:~46.4kD
• Amino Acid Sequence:MKDCSNGCSAPFAGERGSEEVAETFRAKDLIITPATVLKEKPDPDSLVFGATFTDHMLTVEWSSASGWEKPHIKPFGNLPIHPAASVLHYAVELFEGLKAFRGVDNKIRLFRPDLNMDRMCRSAVRTTLPMFDKEELLKCILQLLQIDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPSKALLFVILSPVGPYFSSGSFTPVSLWANPKYIRAWKGGTGDCKMGGNYGASLLAQCEAVENGCQQVLWLYGKDNQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRQSILELAQQWGEFKVCERHLTMDDLATALEGNRVKEMFGSGTACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTIELP
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.