85-6088-55　5-hydroxytryptamine Receptor 1D, Recombinant, Human, aa1-38, hFc-Tag 20ug　583436

特徴

• G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction.
• Source:Recombinant protein corresponding to aa1-38 from human 5-hydroxytryptamine receptor 1D, fused to hFc-Tag at C-terminal, expressed in Mammalian cell.
• Molecular Weight:~33.1kD
• Amino Acid Sequence:MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.