85-6054-03　IARS, Recombinant, Human, aa1172-1262, Gst-Tag (Isoleucyl-TRNA Synthetase protein, IleRS protein, OJ protein) 25ug　553925

特徴

• Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5' UTRs. [provided by RefSeq]
• Source:Recombinant protein corresponding to aa1172-1262 from human IARS, fused to Gst-tag at N-terminal.
• Sequencxe:QYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF
• Entrez GeneID:3376
• Gene Symbol:IARS
• Gene Alias:FLJ20736, IARS1, ILRS, PRO0785
• Applications:Suitable for use in ELISA and Western Blot. Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Host:Wheat Germ (in vitro)
• Theoretical MW (kD):35.75Preparation Method:In vitro wheat germ expression system
• Purification:Glutathione Sepharose 4 Fast Flow
• Quality Control:12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage and Stability:Aliquot to avoid repeated freezing and thawing. Store at -70°C. Aliquots are stable for 3-6 months after receipt at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.