Major cellular 3'-to-5' DNA exonuclease which digests single-stranded DNA (ssDNA) and double-stranded DNA (dsDNA) with mismatched 3' termini. Prevents cell-intrinsic initiation of autoimmunity. Acts by metabolizing DNA fragments from endogenous retroelements, including L1, LTR and SINE elements. Unless degraded, these DNA fragments accumulate in the cytosol and activate the IFN-stimulatory DNA (ISD) response and innate immune signaling. Prevents chronic ATM-dependent checkpoint activation, by processing ssDNA polynucleotide species arising from the processing of aberrant DNA replication intermediates. Inefficiently degrades oxidized DNA, such as that generated upon antimicrobial reactive oxygen production or upon absorption of UV light. During GZMA-mediated cell death, contributes to DNA damage in concert with NME1. NME1 nicks one strand of DNA and TREX1 removes bases from the free 3' end to enhance DNA damage and prevent DNA end reannealing and rapid repair.
Source:Recombinant protein corresponding to aa1-242 of human TREX1
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Molecular Weight:~28.0kD
AA Sequence:MGPGARRQGRIVQGRPEMCFCPPPTPLPPLRILTLGTHTPTPCSSPGSAAGTYPTMGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALESPPTSQGPPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYDFPLLQAELAMLGLTSALDGAFCVDSITALKALERASSPSEHGPRKSYSLGSIYTRLY
Protein Length:Partial
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged. The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Involvement in Disease:Aicardi-Goutieres syndrome 1 (AGS1); Systemic lupus erythematosus (SLE); Chilblain lupus 1 (CHBL1); Vasculopathy, retinal, with cerebral leukodystrophy (RVCL)
Subcellular Location:Nucleus, Cytoplasm, cytosol, Endoplasmic reticulum membrane, Peripheral membrane protein
Protein Families:Exonuclease superfamily, TREX family
Tissue Specificity:Detected in thymus, spleen, liver, brain, heart, small intestine and colon.
Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
仕様
Size：20ug
Source Antigen：Recombinant, E. coli
Grade：Highly Purified
Purity：≥85% (SDS-PAGE)
Form：Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Briefly centrifuged prior to opening.. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0mg/ml. We recommend adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Default final concentration of glycerol is 50%.
