Recombinant, Human protein for Monoclonal antibody 132948Human SAE1 full-length ORF, aa1-346, recombinant protein with GST-tag at N-terminal.
The ubiquitin-like protein SUMO-1 is conjugated to a variety of proteins including Ran GTPase-activating protein 1 (RanGAP1), IkappaB alpha, and PML. SUMO-1-modified proteins display altered subcellular targeting and/or stability. SAE1 is capable of catalyzing the ATP-dependent formation of a thioester linkage between SUMO-1 and SAE2.
Applications:Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications have not been tested.
Recommended Dilution:Immunofluorescence: 10ug/mlImmunohistochemistry (FFPE): 3ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
Storage and Stability:Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Stable for 3 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：10ug
Source Antigen：Recombinant, Human from Wheat Germ
Grade：Affinity Purified
Purity：Purified by Glutathione Sepharose affinity chromatography.
Form：Supplied as a liquid in 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer.
Calc Applications Abbrev：E IF IHC WB
Calc Crossreactivity：Hu
Immunogen：Full length recombinant corresponding to aa1-346 from SAE1 with GST tag. MW of the GST tag alone is 26kD.
