85-6016-13　［取扱停止］Succinate Dehydrogenase [Ubiquinone] Flavoprotein Subunit, Mitochondrial, Recombinant, Human, aa44-293, GST-Tag (SDHA) 20ug　518118

特徴

• Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Can act as a tumor suppressor.
• Source:Recombinant protein corresponding to aa44-293 of partial human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial, fused to GST-Tag at N-terminal, expressed in E. coli.
• Molecular Weight:~54.1kD
• Amino Acid Sequence:SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.