85-6014-03　Mitogen-Activated Protein Kinase 5, Recombinant, Oryza Sativa Subsp. Japonica, aa1-369, His-Tag, Myc-Tag (MPK5) 20ug　518007

特徴

• Involved in disease resistance and abiotic stress tolerance signaling pathways. Acts as a positive regulator of drought, salt and cold tolerance. Negatively modulates pathogenesis-related (PR) gene expression and broad-spectrum disease resistance. Functions downstream of CPK18 in a signaling pathway that represses defense gene expression and negatively regulates resistance to rice blast fungus. Phosphorylated by CPK18 at Thr-14 and Thr-32 and activated independently of MAP kinase kinase (MKK) phosphorylation.
• Source:Recombinant full length protein corresponding to aa1-369 of Oryza sativa subsp. japonica (Rice) Mitogen-Activated Protein Kinase 5, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli.
• Molecular Weight:~48kD
• AA Sequence:MDGAPVAEFRPTMTHGGRYLLYDIFGNKFEVTNKYQPPIMPIGRGAYGIVCSVMNFETREMVAIKKIANAFNNDMDAKRTLREIKLLRHLDHENIIGIRDVIPPPIPQAFNDVYIATELMDTDLHHIIRSNQELSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPLFPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFASMFPRVQPAALDLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQKALNEDQMKQLIFNEAIEMNPNIRY
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.