This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Partial recombinant protein corresponding to aa24-145 of human Glucagon-Like Peptide 1 Receptor, fused to 10xHis-Tag at N-terminal, expressed in Baculovirus.
Molecular Weight:~16.8kD
AA Sequence:RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
仕様
Size：20ug
Source Antigen：Recombinant, Baculovirus
Grade：Purified
Purity：≥85% (SDS-PAGE)
Form：Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.
