85-6010-91　CMRF35-Like Molecule 1, Recombinant, Rat, aa19-181, His-Sumo-Tag, Myc-Tag (Cd300lf) 100ug　517845

特徴

• Acts as an inhibitory receptor for myeloid cells and mast cells. Positively regulates the phagocytosis of apoptotic cells (efferocytosis) via phosphatidylserine (PS) recognition; recognizes and binds PS as a ligand which is expressed on the surface of apoptotic cells. Plays an important role in the maintenance of immune homeostasis, by promoting macrophage-mediated efferocytosis and by inhibiting dendritic cell-mediated efferocytosis. Negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses via binding to ceramide and sphingomyelin which act as ligands. May act as a coreceptor for interleukin 4 (IL-4). Associates with and regulates IL-4 receptor alpha-mediated responses by augmenting IL-4- and IL-13-induced signaling. Negatively regulates the Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through activation of PTPN6/SHP-1 and PTPN11/SHP-2. Inhibits osteoclast formation. Induces macrophage cell death upon engagement.
• Source:Recombinant protein corresponding to aa19-181 of rat CMRF35-Like Molecule 1, fused to 10xHis-Sumo-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli.
• Molecular Weight:~38.3kD
• AA Sequence:AQDPVTGPEEVSGYEQGSLTVWCRYGSWWKDYSKYWCRGPKRSSCEIRVETDASERLVKENHVSIRDDQTNFTFTVTMEDLRMSDAGIYWCGITKAGYDHMFKVHVSINPVPTTPTTTSTTTIFTVTTTVKETSTLSTQTSHYSDNRYDSGGVGDGNGFLDLS
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.