Belongs to the small heat shock protein (HSP20) family.
Source:Recombinant protein corresponding to aa2-144 of Mycobacterium Bovis (strain ATCC BAA-935 / AF2122/97) 14kD Antigen, fused to 9xHis-Tag at C-terminal, expressed in Baculovirus.
Molecular Weight:~18.1kD
AA Sequence:ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
仕様
Size：20ug
Source Antigen：Recombinant, Baculovirus
Grade：Purified
Purity：≥85% (SDS-PAGE)
Form：Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 10% glycerol.
