85-6000-93　Tumor Necrosis Factor Receptor Superfamily Member 5, Recombinant, Human, aa21-193, Fc-Tag (CD40) 50ug　516827

特徴

• Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.
• Partial recombinant protein corresponding to the extracellular domain, aa21-193, of human Tumor Necrosis Factor Receptor Superfamily Member 5, fused to hFC-Tag at C-terminal, expressed in mammalian cell.
• Molecular Weight:~46.3kD
• Biological Activity:The ED50 as determined by its ability to bind human TNFSF5 in functional ELISA is less than 20ug/ml.
• AA Sequence:EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
• Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.