85-6000-88　［取扱停止］Tumor Necrosis Factor Receptor Superfamily Member 4, Recombinant, Mouse, aa20-211, Fc-Tag (Tnfrsf4) 10ug　516825

特徴

• Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).
• Source:Recombinant partial protein corresponding to aa20-211 of mouse Tumor Necrosis Factor Receptor Superfamily Member 4, fused to Fc-Tag at C-terminal, expressed in mammalian cell.
• Molecular Weight:~48.1kD
• Biological Activity:The ED50 as determined by its ability to bind mouse TNFSF4 in functional ELISA is less than 2ug/ml.
• Endotoxin:<1EU/ug (LAL).
• AA Sequence:VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
• Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.