85-6000-87　Tumor Necrosis Factor Receptor Superfamily Member 4, Recombinant, Human, aa29-216, His-Tag (TNFRSF4) 50ug　516824

特徴

• Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.
• Source:Recombinant partial protein corresponding to aa29-216 of human Tumor Necrosis Factor Receptor Superfamily Member 4, fused to His-Tag at C-terminal, expressed in mammalian cell.
• Molecular Weight:~21kD
• Biological Activity:The ED50 as determined by its ability to bind human TNFSF4 in functional ELISA is less than 25ug/ml.
• Endotoxin:<1EU/ug (LAL).
• AA Sequence:LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
• Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.