85-6000-80　Tumor Necrosis Factor Ligand Superfamily Member 4, Recombinant, Human, aa51-183, His-Tag (TNFSF4) 50ug　516821

特徴

• Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
• Source:Recombinant partial protein corresponding to aa51-183 of human Tumor Necrosis Factor Ligand Superfamily Member 4, fused to His-Tag at N-terminal, expressed in mammalian cell.
• Molecular Weight:~16.3kD
• Biological Activity:The ED50 as determined by its ability to bind human OX40 in functional ELISA is less than 20ug/ml.
• Endotoxin:<1EU/ug (LAL).
• AA Sequence:QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
• Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.