85-4785-48　F1 Capsule Antigen, Recombinant, Yersinia Pestis, aa22-170, His-Tag (caf1) 20ug　405923

特徴

• Recombinant protein corresponding to aa22-170 with a 6X His-Tag at the N-terminal from Yersinia Pestis F1 Capsule Antigen, expressed in E. coli.
• Molecular Weight:~19.6kD
• Amino Acid Sequence:ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
• Important Note:This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
• Toxicity and Hazards: All products should be handled by qualified personnel only, trained in laboratory procedures.