Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Recombinant protein corresponding to aa1-172 from full length Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase, fused to 10X His-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in Baculovirus.
Molecular Weight:~22.7kD
AA Sequence:MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG
Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
仕様
Size：20ug
Source Antigen：Recombinant, Baculovirus
Grade：Purified
Purity：≥90% (SDS-PAGE)
Form：Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.
