Could participate in the normal pathway of protein export.
Source:Recombinant full length protein corresponding to aa1-124 from E. coli Acidic Protein MsyB, fused to His-tag at C-terminal, expressed in Baculovirus.
Molecular Weight:~16.3kD
AA Sequence:MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER
Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
仕様
Size:20ug
Source Antigen:Recombinant, Baculovirus
Grade:Purified
Purity:~85% (SDS-PAGE)
Form:Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 10% glycerol.