Three types of arginine methylation exist in mammalian cells: monomethylarginine (MMA), asymmetric dimethylarginine (ADMA) and symmetric dimethylarginine (SDMA). Type I PRMTs ((CARM1, PRMT1, PRMT2, PRMT3, PRMT6, and PRMT8) catalyze ADMA, while type II PRMTs (e.g. PRMTs 5 and 7) catalyze SDMA. Type II PRMTs are found to be strongly implicated in diseases like cancer. For example, PRMT5 plays a role in the repression of certain tumor suppressor genes such as RB tumor suppressors while PRMT7 overexpression is observed in breast cancer
Source:Recombinant protein corresponding to the complex of human PRMT5 (GenBank Accession No. NM_006109), aa2-637(end), with N-terminal FLAG-Avi tag, and human MEP50 (GenBank Accession No. NM_024102) with N-terminal His-Tag, aa2-342(end), coexpressed in HEK293 cells.
Molecular Weight:~73kD (PRMT5), ~38kD (MEP50)
AA Sequence:PRMT5 Sequence: MDYKDDDDKGLNDIFEAQKIEWHEAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWR CSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Storage and Stability:Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：20ug
Source Antigen：Recombinant, HEK293 cells
Grade：Purified
Purity：~90% (SDS-PAGE)
Form：Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 80ug/mL FLAG peptide, 3mM DTT, 20% glycerol. Labeled with Biotin.
