PRMT3 is a protein arginine methyltransferase that catalyze the formation of asymmetric N(G),N(G)-dimethylarginine (ADMA) residues in proteins. 40S ribosomal protein S2 is a physiological substrate of PRMT3 and PRMT3 regulates ribosome biosynthesis at a stage beyond pre-rRNA processing. DAL-1 (differentially expressed in adenocarcinoma of the lung)/4.1B is a tumor suppressor gene that can significantly inhibits PRMT3 methylation of cellular substrates. Modulation of post-translational methylation may be an important mechanism through which DAL-1/4.1B affects tumor cell growth.
Source:Recombinant protein corresponding to aa2-end from human PRMT3, fused to GST-Tag at N-terminal, expressed in E. coli.
Molecular Weight:~86kD
Specific Activity:~490pmol/min/µg
Assay Conditions:50ul reaction mix (20mM phosphate buffer pH 7.4, 20uM S-adenosyl methionine, and 1-10ng methyltransferase PRMT3) add to the wells coated with the substrate. Incubate at room temperature for 1 hr. Add antibody against methylated R3 residue of histone H4, incubate 1 hr. Add secondary HRP-labeled antibody and incubate 30 min. Finally, add HRP chemiluminescent substrates and read luminesence.
AA Sequence:MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFKDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDH PPKSDLVPRGSCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNST QTYGLQ
Storage and Stability:Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
Source Antigen：Recombinant, E. coli
Grade：Purified
Purity：~75% (SDS-PAGE)
Form：Supplied as a liquid in 45mM Tris-HCl, pH 8.0, 124mM sodium chloride, 2.4mM potassium chloride, 18mM glutathione, 3mM DTT, 10% glycerol.
