85-4723-10　S100A1, Recombinant, Human, aa2-94, His-SUMO-Tag (Protein S100-A1) 20ug　375176

特徴

• Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.
• Source:Recombinant protein corresponding to aa2-94 from human S100A1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli.
• Molecular Weight:~26.4kD
• Amino Acid Sequence:GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVAC
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.