85-4697-73　Kcne2, Recombinant, Rat, aa1-123, His-Tag (Potassium Voltage-gated Channel Subfamily E Member 2) 100ug　373903

特徴

• Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with KCNQ1/KCLQT1 and elicit a voltage-independent current.
• Source:Recombinant protein corresponding to aa1-123 from rat Kcne2, fused to His-Tag at N-terminal, expressed in E. coli.
• Molecular Weight:~18.4kD
• AA Sequence:MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.