85-4693-87　HYP2, Recombinant, Saccharomyces Cerevisiae, aa2-157, His-SUMO-Tag (Eukaryotic Translation Initiation Factor 5A-1) 100ug　373716

特徴

• mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Essential for polarized growth, a process necessary for G1/S transition. May mediate large range of effects of the polyamine spermidine in the cell.
• Source:Recombinant protein corresponding to aa2-157 from saccharomyces cerevisiae HYP2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli.
• Molecular Weight:~33kD
• AA Sequence:SDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.