85-4682-74　EIF4EBP3, Recombinant, Human, aa1-100, His-SUMO-Tag (Eukaryotic Translation Initiation Factor 4E-binding Protein 3) 100ug　373163

特徴

• Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation.
• Source:Recombinant protein corresponding to aa1-100 from human EIF4EBP3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli.
• Molecular Weight:~26.9kD
• Amino Acid Sequence:MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.