85-4678-85　Cytomegalovirus Envelope Glycoprotein H, Recombinant, Human, aa24-195, His-Tag (gH) 20ug　372972

特徴

• The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. Fusion of with fibroblasts requires the additional receptor-binding protein gO, which forms a complex with gH/gL.
• Source:Partial recombinant protein corresponding to aa24-195 from human gH, fused to His-Tag at N-terminal, expressed in Yeast.
• Molecular Weight:~21.8kD
• AA Sequence:RYGADAASEALDPHAFHLLLNTYGRPIRFLRENTTQCTYNSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGPLAEQFLNQVDLTETLERYQQRLNTYALVSKDLASYRSFSQQLKAQDSLGQQPTTVPPPIDLSIPHVWMPPQTTPHDWKGSHTTSGLHRPHFNQT
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.